Antibodies for $/€ 289

Jump to Filters
View as table Download
Igf2bp3 Rabbit Polyclonal Antibody
TA345973

USD 475.00

5 Days

Rabbit Polyclonal Anti-Igf2bp3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Igf2bp3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QQNPSPQLRGRRGPGQRGSSRQASPGSVSKQKPCDLPLRLLVPTQFVGAI