Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-MLX Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MLX antibody: synthetic peptide directed towards the C terminal of human MLX. Synthetic peptide located within the following region: LRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLF

Rabbit Polyclonal Anti-MLX Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MLX antibody: synthetic peptide directed towards the N terminal of human MLX. Synthetic peptide located within the following region: GSCENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRP