Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-P4HB Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-P4HB antibody: synthetic peptide directed towards the N terminal of human P4HB. Synthetic peptide located within the following region: TIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLV

Rabbit Polyclonal Anti-P4HB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-P4HB antibody: synthetic peptide directed towards the C terminal of human P4HB. Synthetic peptide located within the following region: DRTVIDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDD