Rabbit Polyclonal Anti-STK3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STK3 antibody: synthetic peptide directed towards the C terminal of human STK3. Synthetic peptide located within the following region: IEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQ |
Rabbit Polyclonal Anti-MAK Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAK antibody: synthetic peptide directed towards the C terminal of human MAK. Synthetic peptide located within the following region: WNTKTGRGQFSGRTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR |
Rabbit Polyclonal Anti-BMP2K Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMP2K antibody: synthetic peptide directed towards the C terminal of human BMP2K. Synthetic peptide located within the following region: AQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSV |
Rabbit Polyclonal Anti-DMPK Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DMPK antibody: synthetic peptide directed towards the middle region of human DMPK. Synthetic peptide located within the following region: TRLGRGGAGDFRTHPFFFGLDWDGLRDSVPPFTPDFEGATDTCNFDLVED |
Germany
Japan
United Kingdom
China
