Antibodies for $/€ 289

Jump to Filters
View as table Download
CSDC2 Rabbit Polyclonal Antibody
TA343811

USD 410.00

5 Days

Rabbit Polyclonal Anti-CSDC2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSDC2 antibody: synthetic peptide directed towards the N terminal of human CSDC2. Synthetic peptide located within the following region: MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLP