Antibodies for $/€ 289

Jump to Filters
View as table Download
CUG BP1 (CELF1) Rabbit Polyclonal Antibody
TA345754

USD 475.00

5 Days

Rabbit Polyclonal Anti-CUGBP1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CUGBP1 antibody: synthetic peptide directed towards the N terminal of human CUGBP1. Synthetic peptide located within the following region: QMKPADSEKNNVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGP