Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Rabbit Polyclonal Anti-TPM1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPM1 antibody: synthetic peptide directed towards the N terminal of human TPM1. Synthetic peptide located within the following region: DRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQE |
Rabbit Polyclonal Anti-TPM2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPM2 antibody: synthetic peptide directed towards the C terminal of human TPM2. Synthetic peptide located within the following region: AETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL |
Rabbit Polyclonal Anti-Myh7 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Myh7 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQ |
Germany
Japan
United Kingdom
China
