Antibodies for $/€ 289

Jump to Filters
View as table Download
UBE2L3 Rabbit Polyclonal Antibody
TA344149

USD 410.00

5 Days

Rabbit Polyclonal Anti-BSDC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BSDC1 antibody: synthetic peptide directed towards the N terminal of human BSDC1. Synthetic peptide located within the following region: VISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKARLYSLQSDPATYC