Antibodies for $/€ 289

Jump to Filters
View as table Download
Aspartate Aminotransferase (GOT1) Rabbit Polyclonal Antibody
TA346569

USD 475.00

5 Days

Rabbit Polyclonal Anti-GOT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV