Antibodies for $/€ 289

Jump to Filters
View as table Download
USE1 Rabbit Polyclonal Antibody
TA345255

USD 475.00

5 Days

Rabbit Polyclonal Anti-MDS032 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MDS032 antibody: synthetic peptide directed towards the N terminal of human MDS032. Synthetic peptide located within the following region: ELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASE