Antibodies for $/€ 289

Jump to Filters
View as table Download
CPXCR1 Rabbit Polyclonal Antibody
TA345470

USD 475.00

5 Days

Rabbit Polyclonal Anti-CPXCR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CPXCR1 antibody: synthetic peptide directed towards the middle region of human CPXCR1. Synthetic peptide located within the following region: WANQLAAVAAGARVAGTQACATETIDTSRVSLRAPQEFMTSHSEAGSRIV