Antibodies for $/€ 289

Jump to Filters
View as table Download
Deleted in azoospermia 4 (DAZ4) Rabbit Polyclonal Antibody
TA345710

USD 475.00

5 Days

Rabbit Polyclonal Anti-DAZ4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DAZ4 antibody: synthetic peptide directed towards the N terminal of human DAZ4. Synthetic peptide located within the following region: MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDAR