Antibodies for $/€ 289

Jump to Filters
View as table Download
SAM68 (KHDRBS1) Rabbit Polyclonal Antibody
TA345976

USD 475.00

5 Days

Rabbit Polyclonal Anti-KHDRBS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KHDRBS1 antibody: synthetic peptide directed towards the N terminal of human KHDRBS1. Synthetic peptide located within the following region: LPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKN
SAM68 (KHDRBS1) Rabbit Polyclonal Antibody
TA345977

USD 475.00

5 Days

Rabbit Polyclonal Anti-KHDRBS1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KHDRBS1 antibody: synthetic peptide directed towards the middle region of human KHDRBS1. Synthetic peptide located within the following region: PPPAPETYEEYGYDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSY