Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-MINA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MINA antibody: synthetic peptide directed towards the N terminal of human MINA. Synthetic peptide located within the following region: MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSSLFESLISPIK

Rabbit Polyclonal Anti-MINA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MINA antibody: synthetic peptide directed towards the N terminal of human MINA. Synthetic peptide located within the following region: MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSSLFESLISPIK