Antibodies for $/€ 289

Jump to Filters
View as table Download
SLC13A3 Rabbit Polyclonal Antibody
TA346061

USD 410.00

5 Days

Rabbit Polyclonal Anti-SLC13A3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC13A3 antibody: synthetic peptide directed towards the middle region of human SLC13A3. Synthetic peptide located within the following region: GLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFCMF