Antibodies for $/€ 289

Jump to Filters
View as table Download
SOX15 Rabbit Polyclonal Antibody
TA343646

USD 410.00

5 Days

Rabbit Polyclonal Anti-SOX15 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SOX15 antibody: synthetic peptide directed towards the middle region of human SOX15. Synthetic peptide located within the following region: ASGGPLWGPGYATTQPSRGFGYRPPSYSTAYLPGSYGSSHCKLEAPSPCS