Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-C9orf127 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C9orf127 antibody: synthetic peptide directed towards the middle region of human C9orf127. Synthetic peptide located within the following region: THNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLCLSNLMFLPPV

Rabbit Polyclonal Anti-C9orf127 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C9orf127 antibody: synthetic peptide directed towards the N terminal of human C9orf127. Synthetic peptide located within the following region: MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFS