Antibodies for $/€ 289

Jump to Filters
View as table Download
RCC2 Rabbit Polyclonal Antibody
TA344837

USD 475.00

5 Days

Rabbit Polyclonal Anti-RCC2 Antibody - middle region

Applications IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RCC2 antibody: synthetic peptide directed towards the middle region of human RCC2. Synthetic peptide located within the following region: RIRSLACGKSSIIVAADESTISWGPSPTFGELGYGDHKPKSSTAAQEVKT