Antibodies for $/€ 289

Jump to Filters
View as table Download
Suppressor of Fused (SUFU) Rabbit Polyclonal Antibody
TA345193

USD 475.00

5 Days

Rabbit Polyclonal Anti-SUFU Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SUFU antibody: synthetic peptide directed towards the middle region of human SUFU. Synthetic peptide located within the following region: LQILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPEKKLKVSILPDVVFD
Retinoid X Receptor gamma (RXRG) Rabbit Polyclonal Antibody
TA343644

USD 410.00

5 Days

Rabbit Polyclonal Anti-RXRG Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRG antibody: synthetic peptide directed towards the C terminal of human RXRG. Synthetic peptide located within the following region: LEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDT