Rabbit Polyclonal Anti-ZKSCAN4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZKSCAN4 antibody: synthetic peptide directed towards the N terminal of human ZKSCAN4. Synthetic peptide located within the following region: EVRAPCSPARGPERSRQRFRGFRYPEAAGPREALSRLRELCGQWLQPEMH |
Rabbit Polyclonal Anti-ZNF307 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF307 antibody: synthetic peptide directed towards the C terminal of human ZNF307. Synthetic peptide located within the following region: FTRNRSLIEHQKIHTGEKPYQCDTCGKGFTRTSYLVQHQRSHVGKKTLSQ |
Germany
Japan
United Kingdom
China