Antibodies for $/€ 289

Jump to Filters
View as table Download
HMGB2 Rabbit Polyclonal Antibody
TA344432

USD 475.00

5 Days

Rabbit Polyclonal Anti-HMGB2 Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGB2 antibody: synthetic peptide directed towards the middle region of human HMGB2. Synthetic peptide located within the following region: DREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLS
HMGB2 Rabbit Polyclonal Antibody
TA344431

USD 475.00

5 Days

Rabbit Polyclonal Anti-HMGB2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGB2 antibody: synthetic peptide directed towards the middle region of human HMGB2. Synthetic peptide located within the following region: SEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYE