Rabbit Polyclonal Anti-MBD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBD1 antibody: synthetic peptide directed towards the C terminal of human MBD1. Synthetic peptide located within the following region: VKQEPPDPEEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRD |
Rabbit Polyclonal Anti-MBD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBD1 antibody: synthetic peptide directed towards the middle region of human MBD1. Synthetic peptide located within the following region: CKVWETEDTVEPTSTSWNPRGWPGTHVSLSPPPASMMWVSCRRSWCPSSQ |
Germany
Japan
United Kingdom
China