Rabbit Polyclonal Anti-PHF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHF1 antibody: synthetic peptide directed towards the N terminal of human PHF1. Synthetic peptide located within the following region: MAQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGT |
Rabbit Polyclonal Anti-PHF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHF1 antibody: synthetic peptide directed towards the C terminal of human PHF1. Synthetic peptide located within the following region: SAPPSPLCRSLSPGTGGGVRGGVGYLSRGDPVRVLARRVRPDGSVQYLVE |
Germany
Japan
United Kingdom
China