Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-TFEB Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TFEB antibody: synthetic peptide directed towards the middle region of human TFEB. Synthetic peptide located within the following region: DFSHSLSFGGREDEGPPGYPEPLAPGHGSPFPSLSKKDLDLMLLDDSLLP

Rabbit Polyclonal Anti-TFEB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TFEB antibody: synthetic peptide directed towards the C terminal of human TFEB. Synthetic peptide located within the following region: SLSKKDLDLMLLDDSLLPLASDPLLSTMSPEASKASSRRSSFSMEEGDVL