Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-TLX2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TLX2 antibody: synthetic peptide directed towards the C terminal of human TLX2. Synthetic peptide located within the following region: QQDALPRPLRPPLPPDPLCLHNSSLFALQNLQPWAEDNKVASVSGLASVV

Rabbit Polyclonal Anti-TLX2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TLX2 antibody: synthetic peptide directed towards the N terminal of human TLX2. Synthetic peptide located within the following region: MEPGMLGPHNLPHHEPISFGIDQILSGPETPGGGLGLGRGGQGHGENGAF