Antibodies for $/€ 289

Jump to Filters
View as table Download
CPA6 Rabbit Polyclonal Antibody
TA344790

USD 475.00

5 Days

Rabbit Polyclonal Anti-CPA6 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CPA6 antibody: synthetic peptide directed towards the middle region of human CPA6. Synthetic peptide located within the following region: QSVYGVRYRYGPASTTLYVSSGSSMDWAYKNGIPYAFAFELRDTGYFGFL