Antibodies for $/€ 289

Jump to Filters
View as table Download
SMN1 Rabbit Polyclonal Antibody
TA345684

USD 475.00

5 Days

Rabbit Polyclonal Anti-SMN1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SMN1 antibody: synthetic peptide directed towards the N terminal of human SMN1. Synthetic peptide located within the following region: KAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKV