Antibodies for $/€ 289

Jump to Filters
View as table Download
ORC4L (ORC4) Rabbit Polyclonal Antibody
TA344603

USD 475.00

5 Days

Rabbit Polyclonal Anti-ORC4L Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ORC4L antibody: synthetic peptide directed towards the middle region of human ORC4L. Synthetic peptide located within the following region: VLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVV