Antibodies for $/€ 289

Jump to Filters
View as table Download
POLR3B Rabbit Polyclonal Antibody
TA346793

USD 475.00

5 Days

Rabbit Polyclonal Anti-POLR3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR3B antibody: synthetic peptide directed towards the C terminal of human POLR3B. Synthetic peptide located within the following region: IEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQED