Antibodies for $/€ 289

Jump to Filters
View as table Download
GTF3C5 Rabbit Polyclonal Antibody
TA343678

USD 475.00

5 Days

Rabbit Polyclonal Anti-GTF3C5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF3C5 antibody: synthetic peptide directed towards the C terminal of human GTF3C5. Synthetic peptide located within the following region: SKRPALFSSSAKADGGKEQLTYESGEDEEDEEEEEEEEEDFKPSDGSENE