Rabbit Polyclonal Anti-C17orf48 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C17orf48 antibody: synthetic peptide directed towards the middle region of human C17orf48. Synthetic peptide located within the following region: KYEQCMKILREHNPNTELNSPQGLSEPQFVQFNGGFSQEQLNWLNEVLTF |
Rabbit Polyclonal Anti-C17orf48 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C17orf48 antibody: synthetic peptide directed towards the N terminal of human C17orf48. Synthetic peptide located within the following region: MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLL |
Germany
Japan
United Kingdom
China