Antibodies for $/€ 289

Jump to Filters
View as table Download
BTBD6 Rabbit Polyclonal Antibody
TA345479

USD 410.00

5 Days

Rabbit Polyclonal Anti-BTBD6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BTBD6 antibody: synthetic peptide directed towards the N terminal of human BTBD6. Synthetic peptide located within the following region: FVVGPPGATRTVPAHKYVLAVGSSVFYAMFYGDLAEVKSEIHIPDVEPAA
BTBD6 Rabbit Polyclonal Antibody
TA345480

USD 475.00

5 Days

Rabbit Polyclonal Anti-BTBD6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BTBD6 antibody: synthetic peptide directed towards the middle region of human BTBD6. Synthetic peptide located within the following region: GKAFNRCSHLTRHKKIHTAVKRYKCEECGKAFKRCSHLNEHKRVQRGEKS