Antibodies for $/€ 289

Jump to Filters
View as table Download
Matrilin 2 (MATN2) Rabbit Polyclonal Antibody
TA344662

USD 475.00

5 Days

Rabbit Polyclonal Anti-MATN2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MATN2 antibody: synthetic peptide directed towards the middle region of human MATN2. Synthetic peptide located within the following region: AVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALED