Antibodies for $/€ 289

Jump to Filters
View as table Download
RBM14 Rabbit Polyclonal Antibody
TA345951

USD 475.00

5 Days

Rabbit Polyclonal Anti-RBM14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RBM14 antibody: synthetic peptide directed towards the N terminal of human RBM14. Synthetic peptide located within the following region: YAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGD