Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-SLC6A2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC6A2 antibody: synthetic peptide directed towards the middle region of human SLC6A2. Synthetic peptide located within the following region: STLSGSTFWAVVFFVMLLALGLDSSMGGMEAVITGLADDFQVLKRHRKLF

Rabbit Polyclonal Anti-SLC6A2 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC6A2 antibody: synthetic peptide directed towards the middle region of human SLC6A2. Synthetic peptide located within the following region: FTPAAEFYERGVLHLHESSGIHDIGLPQWQLLLCLMVVVIVLYFSLWKGV