Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-HADHB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HADHB antibody: synthetic peptide directed towards the C terminal of human HADHB. Synthetic peptide located within the following region: LLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAE

ACAA2 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Bovine, Chicken, Human, Mouse, Porcine, Rat, African clawed frog
Immunogen Synthetic peptide directed towards the N terminal of human ACAA2