Rabbit Polyclonal Anti-A1CF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-A1CF antibody: synthetic peptide directed towards the N terminal of human A1CF. Synthetic peptide located within the following region: EAVCLGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEKENGQRKYGGP |
Rabbit Polyclonal Anti-A1CF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-A1CF antibody is: synthetic peptide directed towards the N-terminal region of Human A1CF. Synthetic peptide located within the following region: LGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEKENGQRKYGGPPPGW |
Germany
Japan
United Kingdom
China
