Antibodies for $/€ 289

Jump to Filters
View as table Download
AARE (APEH) Rabbit Polyclonal Antibody
TA346557

USD 475.00

5 Days

Rabbit Polyclonal Anti-APEH Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-APEH antibody: synthetic peptide directed towards the N terminal of human APEH. Synthetic peptide located within the following region: VYEDDCFGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDDEIAR
AARE (APEH) Rabbit Polyclonal Antibody
TA346558

USD 475.00

5 Days

Rabbit Polyclonal Anti-APEH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APEH antibody: synthetic peptide directed towards the middle region of human APEH. Synthetic peptide located within the following region: GSTGFGQDSILSLPGNVGHQDVKDVQFAVEQVLQEEHFDASHVALMGGSH