Antibodies for $/€ 289

Jump to Filters
View as table Download
APOBEC2 Rabbit Polyclonal Antibody
TA345985

USD 410.00

5 Days

Rabbit Polyclonal Anti-APOBEC2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APOBEC2 antibody: synthetic peptide directed towards the N terminal of human APOBEC2. Synthetic peptide located within the following region: VATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRN
APOBEC2 Rabbit Polyclonal Antibody
TA345984

USD 475.00

5 Days

Rabbit Polyclonal Anti-APOBEC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APOBEC2 antibody: synthetic peptide directed towards the middle region of human APOBEC2. Synthetic peptide located within the following region: CKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADIL