Rabbit Polyclonal Anti-APOL5 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-APOL5 antibody: synthetic peptide directed towards the C terminal of human APOL5. Synthetic peptide located within the following region: PVVEHQPRLGPGVALRTPKRTVSAPRMLGHQPAPPAPARKGRQAPGRHRQ |
Rabbit Polyclonal Anti-APOL5 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-APOL5 antibody: synthetic peptide directed towards the C terminal of human APOL5. Synthetic peptide located within the following region: QHHRHLPQKASQTCSSSRGRAVRGSRVVKPEGSRSPLPWPVVEHQPRLGP |
Germany
Japan
United Kingdom
China