Rabbit Polyclonal Anti-ARC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARC antibody: synthetic peptide directed towards the N terminal of human ARC. Synthetic peptide located within the following region: ELDHRTSGGLHAYPGPRGGQVAKPNVILQIGKCRAEMLEHVRRTHRHLLA |
Rabbit Polyclonal Anti-ARC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ARC antibody is: synthetic peptide directed towards the C-terminal region of Human ARC. Synthetic peptide located within the following region: RHPLPKTLEQLIQRGMEVQDDLEQAAEPAGPHLPVEDEAETLTPAPNSES |
Germany
Japan
United Kingdom
China