Rabbit Polyclonal Anti-BCL11A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BCL11A antibody: synthetic peptide directed towards the N terminal of human BCL11A. Synthetic peptide located within the following region: MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQ |
Rabbit Polyclonal Anti-Bcl11a Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Bcl11a antibody is: synthetic peptide directed towards the N-terminal region of Rat Bcl11a. Synthetic peptide located within the following region: KREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIF |
Germany
Japan
United Kingdom
China
