Rabbit Polyclonal Anti-BIVM Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BIVM antibody: synthetic peptide directed towards the middle region of human BIVM. Synthetic peptide located within the following region: PFGTIRQESQPPTHAQGIAKSESEDNISKKQHGRLGRSFSASFHQDSAWK |
Rabbit Polyclonal Anti-BIVM Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BIVM antibody: synthetic peptide directed towards the middle region of human BIVM. Synthetic peptide located within the following region: LYKPHGKNKTAGETASGALSKLTRGLKDESLAYIYHCQNHYFCPIGFEAT |
Germany
Japan
United Kingdom
China