Rabbit Polyclonal Anti-Mrpl48 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Mrpl48 antibody is: synthetic peptide directed towards the C-terminal region of Rat Mrpl48. Synthetic peptide located within the following region: ISGLSATFAEIFLEILQINLPEGVRLSVREHTEEDFKGRFKARPELEELL |
Rabbit Polyclonal Anti-MRPL48 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MRPL48 antibody: synthetic peptide directed towards the middle region of human MRPL48. Synthetic peptide located within the following region: KKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAESYAQYVHNLCNSLSIK |
Germany
Japan
United Kingdom
China