Antibodies for $/€ 289

Jump to Filters
View as table Download
Sarcosine Oxidase (PIPOX) Rabbit Polyclonal Antibody
TA344132

USD 475.00

5 Days

Rabbit Polyclonal Anti-PIPOX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIPOX antibody: synthetic peptide directed towards the C terminal of human PIPOX. Synthetic peptide located within the following region: FVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHG
AOC2 Rabbit Polyclonal Antibody
AP43408PU-N

USD 445.00

2 Weeks

AOC2 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Bovine, Canine, Chicken, Human, Mouse, Rat, Zebrafish, African clawed frog
Immunogen Synthetic peptide directed towards the middle region of human AOC2