Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-KLHL5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLHL5 antibody: synthetic peptide directed towards the n terminal of human KLHL5. Synthetic peptide located within the following region: MSGSRKEFDVKQILKIRWRWFGHQASSPNSTVDSQQGEFWNRGQTGANGG

Rabbit Polyclonal Anti-KLHL5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLHL5 antibody: synthetic peptide directed towards the middle region of human KLHL5. Synthetic peptide located within the following region: LLGDKLYAVGGYDGQAYLNTVEAYDPQTNEWTQVAPLCLGRAGACVVTVK