Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-Wipf1 Antibody - N-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Wipf1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Wipf1. Synthetic peptide located within the following region: MPVPPPPAPPPPPTFALANTEKPSLNKTEQAGRNALLSDISKGKKLKKTV

Rabbit Polyclonal Anti-TMLHE Antibody - C-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Tmlhe antibody is: synthetic peptide directed towards the C-terminal region of Rat Tmlhe. Synthetic peptide located within the following region: ELWVKLKPGKVLFIDNWRVLHGRESFTGYRQLCGCYLTRDDVLNTARILG