Rabbit Polyclonal Anti-APBB1IP Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-APBB1IP antibody: synthetic peptide directed towards the N terminal of human APBB1IP. Synthetic peptide located within the following region: LVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATG |
Rabbit Polyclonal Anti-APBB1IP Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Apbb1ip antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: PPREEFNFSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQK |
Germany
Japan
United Kingdom
China