Rabbit Polyclonal Anti-ATE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATE1 antibody: synthetic peptide directed towards the N terminal of human ATE1. Synthetic peptide located within the following region: CCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTM |
Rabbit Polyclonal Anti-ATE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATE1 antibody: synthetic peptide directed towards the middle region of human ATE1. Synthetic peptide located within the following region: TYVWVPIEQCLPSLENSKYCRFNQDPEAVDEDRSTEPDRLQVFHKRAIMP |
Germany
Japan
United Kingdom
China