Antibodies for $/€ 289

Jump to Filters
View as table Download
AUH Rabbit Polyclonal Antibody
TA345786

USD 475.00

5 Days

Rabbit Polyclonal Anti-AUH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AUH antibody: synthetic peptide directed towards the C terminal of human AUH. Synthetic peptide located within the following region: IGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLARE
Auh Rabbit Polyclonal Antibody
TA345785

USD 475.00

5 Days

Rabbit Polyclonal Anti-Auh Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Auh antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PRRGYSSEVKTEDELRVRHLEEENRGIVVLGINRAYGKNALSKNLLKMLS